PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA25G00034
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 560aa    MW: 62036.9 Da    PI: 7.1454
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA25G00034genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding491.4e-152471148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ede+l+ +v++ G g+W+++ +  g+ R++k+c++rw ++l
       AA25G00034 24 KGPWTAAEDEILAAYVRENGEGNWNAVQKNTGLARCGKSCRLRWANHL 71
                     79******************************************9986 PP

2Myb_DNA-binding507e-1677120146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T++E+ l++++++qlG++ W++ a+ ++ gRt++++k++w++
       AA25G00034  77 KGSFTADEERLIIQLHAQLGNK-WARMAAQLP-GRTDNEIKNYWNT 120
                      799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.8322171IPR017930Myb domain
SMARTSM007171.6E-122373IPR001005SANT/Myb domain
SuperFamilySSF466892.64E-2823118IPR009057Homeodomain-like
PfamPF002492.5E-142471IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-222578IPR009057Homeodomain-like
CDDcd001673.57E-102671No hitNo description
PROSITE profilePS5129425.48872126IPR017930Myb domain
SMARTSM007174.9E-1676124IPR001005SANT/Myb domain
PfamPF002491.6E-1477120IPR001005SANT/Myb domain
CDDcd001672.26E-1179122No hitNo description
Gene3DG3DSA:1.10.10.608.4E-2579124IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009860Biological Processpollen tube growth
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MILYGGGAGR DGGSNDGGVL ILKKGPWTAA EDEILAAYVR ENGEGNWNAV QKNTGLARCG  60
KSCRLRWANH LRPNLKKGSF TADEERLIIQ LHAQLGNKWA RMAAQLPGRT DNEIKNYWNT  120
RLKRLQRQGL PLYPPDIIPN HHNPHHNHPH HHHNHQNHHQ NLYFQPQSSP STSPRPVTTT  180
SSSSFTFHTP TPPETANLLH PLSPHTPQTP SRLSSTPLTS PLSSPRGQYP TLPLFSLPRS  240
PTPLPHHHQN NNNTNNNAFT FPKPPPLLQP PSLLTKRYNN PNRVSTAPFS PVSRDNYTSF  300
LTLLYSSPTP ANTNYHNTND SSSSFHDSFS LNPSSSSASY HPPVLTPSPS FHYNTNSCSF  360
QSNDAVYSMK HELPSNQIGV FDVNNFTDTT EKHNQINVNG GIRRSSSCSL LEDVLEEAEA  420
LDGNGRPSKR RQLTPSPHNN NNGSNNNDNF FSGGFGHFES SDHNVCSLQD MKSKEEESLQ  480
LSSTMQEDIA KLLDWGSDSG EISNGQSSVV TDDNLVLDVH QFASLFPTDS TAAPPALDHN  540
QQHHNNNNNN CSWDDLHGIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-29211241103C-Myb DNA-Binding Domain
1msf_C2e-29211241103C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013714707.10.0PREDICTED: transcription factor MYB28-like
TrEMBLM4F3970.0M4F397_BRARP; Uncharacterized protein
TrEMBLQ9FIA40.0Q9FIA4_ARATH; Similarity to MYB-related transcription factor
STRINGBra035547.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM99391934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55020.11e-116myb domain protein 120